PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7128s0578.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family SRS
Protein Properties Length: 348aa    MW: 37817.1 Da    PI: 6.5554
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7128s0578.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702231.91.1e-711122742154
               DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.......aeaaskrkrel...... 78 
                          r+g+++CqdCGnqakkdC h+RCRtCCksrgfdC+thvkstWvpaakrrerq+qlaa+ +k+ ++a       ++++ +++  +      
  Bostr.7128s0578.1.p 112 RQGNMNCQDCGNQAKKDCPHMRCRTCCKSRGFDCQTHVKSTWVPAAKRRERQAQLAALPAKRIRDAssgggdnDDDDREDE--Kngggdd 199
                          7899******************************************************99999888788775422222222..2456776 PP

               DUF702  79 kskkqsalsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                          ++   sal++t++++a+s+  lets+lP+e+ss+avfrc+rvss+dd++ee+aYqtavsigGhvfkGiLydqG+++
  Bostr.7128s0578.1.p 200 SCGGGSALACTRVVNANSS-GLETSHLPPEISSPAVFRCMRVSSIDDEDEEYAYQTAVSIGGHVFKGILYDQGPSD 274
                          89999***********876.99***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.8E-64115273IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.1E-27117159IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016246.9E-27224272IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009299Biological ProcessmRNA transcription
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MAGLFYLGGR DHNKQDHHHQ DKDHNEDKSN NYLYLYKDEI YNNNKGFEIW PPQYFQQQQN  60
HVAAPTNLYS FGMVPSGGSN NNNRSTNRSL YFNVVSDHEP VRSSTGGFTV TRQGNMNCQD  120
CGNQAKKDCP HMRCRTCCKS RGFDCQTHVK STWVPAAKRR ERQAQLAALP AKRIRDASSG  180
GGDNDDDDRE DEKNGGGDDS CGGGSALACT RVVNANSSGL ETSHLPPEIS SPAVFRCMRV  240
SSIDDEDEEY AYQTAVSIGG HVFKGILYDQ GPSDHHRYSS SLTAETSQHH FNLLDSTASA  300
ATTTAVTAVN SNNGSIDPSS LYTAAAAAAP FNAFVAAGTP FFAPPRS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00152DAPTransfer from AT1G19790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9246760.0AY924676.1 Arabidopsis thaliana hypothetical protein (At1g19790) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010459655.10.0PREDICTED: protein SHI RELATED SEQUENCE 7-like
RefseqXP_010459654.10.0PREDICTED: protein SHI RELATED SEQUENCE 7-like
SwissprotQ9FXH70.0SRS7_ARATH; Protein SHI RELATED SEQUENCE 7
TrEMBLD7KI570.0D7KI57_ARALL; Putative uncharacterized protein
STRINGAT1G19790.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.21e-159SHI-related sequence 7